PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D09G0926
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 392aa    MW: 43445 Da    PI: 9.9982
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D09G0926genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.23.2e-12308359556
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                  +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN +Lk+ +ee +++ 
  Gh_D09G0926 308 RRQRRMIKNRESAARSRARKQAYTVELELELNQLKQENAKLKQLVEENEQKR 359
                  69************************************98885444443333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.3E-10304370IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.921306358IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.8E-12307359No hitNo description
CDDcd147077.77E-24308355No hitNo description
PfamPF001704.1E-10308360IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.13E-10308357No hitNo description
PROSITE patternPS000360311326IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MALFESESVA YGGIKAASPS QAPRSPQQQQ QRQELTRDQS VSSLNKQGSI FSLTLDEIQL  60
KSGKAFGSMN MDEFLANLWN VEENQAPPQL DQNEARDDKD KGNGGQPTLA RQGSFSIPTP  120
LCKKTVDEVW FEIQKELPQQ RKANNIADHE PPQRQQTFGE MTLEDFLIKA GVVQEPSSAS  180
SQQRKVAATR PNGTSLEATY GMGHGAGSSQ QKMLTSIQNS SASLDANFGM GHVMGLGFPG  240
HQIVPSNLAA PGNGYAAAYP IFTQSKNMMG ESSNVAENGN GTNCLLEPVV IQNKKRIIDG  300
PPEVVVERRQ RRMIKNRESA ARSRARKQAY TVELELELNQ LKQENAKLKQ LVEENEQKRK  360
QEVLKRKQSK LPAQRKVVDK MRTVRRTVSL GW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012485099.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1
TrEMBLA0A0D2Q7P00.0A0A0D2Q7P0_G
STRINGPOPTR_0009s16610.11e-122(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116522230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44460.19e-61bZIP family protein